Protein Info for AMB_RS04225 in Magnetospirillum magneticum AMB-1

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 39 to 63 (25 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 270 to 287 (18 residues), see Phobius details PF00892: EamA" amino acids 7 to 141 (135 residues), 69.6 bits, see alignment E=1.5e-23 amino acids 154 to 286 (133 residues), 65.7 bits, see alignment E=2.5e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0827)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W944 at UniProt or InterPro

Protein Sequence (296 amino acids)

>AMB_RS04225 EamA/RhaT family transporter (Magnetospirillum magneticum AMB-1)
MGPIAIYALAALSALFWAANFNLAGPILADMAPLAAASGRFVLAAVIMVVLVAGRGELGA
LLAAARKSGGRLALLGVVGIAGFNLLFFDAMRTTSAVNGALIMATNPLLTAVLAALFLGE
QLPGRQIAALPVALAGVSMVILGGARGEVVFGLGDVEMMGANLAWAVYNVLARRLMPAGS
PLVNAAIPMAAGALVLTAAAGLSGAEFTLPGPKAAAALAAMTVFGSVLAYLFWNAAIARM
GAGRTALFLNLVPVFAASIATLTGTPPNPAQLAGGAVVVAAVIFSMLPRRPQPCLA