Protein Info for AMB_RS04145 in Magnetospirillum magneticum AMB-1

Annotation: homoprotocatechuate degradation operon regulator HpaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 TIGR02337: homoprotocatechuate degradation operon regulator, HpaR" amino acids 19 to 147 (129 residues), 138.9 bits, see alignment E=4.2e-45 PF22381: Staph_reg_Sar_Rot" amino acids 35 to 116 (82 residues), 40.8 bits, see alignment E=4e-14 PF12802: MarR_2" amino acids 42 to 101 (60 residues), 43.5 bits, see alignment E=5.9e-15 PF01047: MarR" amino acids 44 to 102 (59 residues), 35.2 bits, see alignment E=1.9e-12 PF13463: HTH_27" amino acids 44 to 109 (66 residues), 30.3 bits, see alignment E=8.5e-11

Best Hits

Swiss-Prot: 35% identical to FARR_NEIGO: HTH-type transcriptional regulator FarR (farR) from Neisseria gonorrhoeae

KEGG orthology group: None (inferred from 100% identity to mag:amb0811)

Predicted SEED Role

"Homoprotocatechuate degradative operon repressor" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W960 at UniProt or InterPro

Protein Sequence (163 amino acids)

>AMB_RS04145 homoprotocatechuate degradation operon regulator HpaR (Magnetospirillum magneticum AMB-1)
MAGPRSGEHALSTEAFHPNLPLLLAQAREEIISRFRPILNHFGVTEQQWRILRVLRHEEP
LEPRQICDICLFLSPSLTGVLARMEEMDLVRKERVESDHRRVLVHMTEKSRALVDAAIPL
ITEQYRHIEDVIGAKQTVELYDVLTKLTALHGAAIPLVKLPSK