Protein Info for AMB_RS04135 in Magnetospirillum magneticum AMB-1

Annotation: TRAP transporter small permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details PF04290: DctQ" amino acids 39 to 166 (128 residues), 65.8 bits, see alignment E=1.9e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0809)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W962 at UniProt or InterPro

Protein Sequence (177 amino acids)

>AMB_RS04135 TRAP transporter small permease (Magnetospirillum magneticum AMB-1)
MTELLYPPAERRAHDVIDRWLNRAAEAMAWTGGATLVAMVIMSLISIISRKLGFQPVNGD
VEMMQMGNAIAAAAFIPLCTLRGDHLRVEFFTEGFRPKVKRRFDAVGDSLLALVLAVLAW
RTGFQALDGLDTGEVSPLLAVPQWIPVLLMVPSLALTGICAIYRTALEFTVGLEIPS