Protein Info for AMB_RS03995 in Magnetospirillum magneticum AMB-1

Annotation: tRNA epoxyqueuosine(34) reductase QueG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR00276: epoxyqueuosine reductase" amino acids 19 to 350 (332 residues), 412 bits, see alignment E=8.6e-128 PF08331: QueG_DUF1730" amino acids 68 to 144 (77 residues), 82.5 bits, see alignment E=4.2e-27 PF00037: Fer4" amino acids 195 to 212 (18 residues), 21.3 bits, see alignment (E = 4.5e-08) PF13484: Fer4_16" amino acids 196 to 260 (65 residues), 76.2 bits, see alignment E=6.8e-25

Best Hits

Swiss-Prot: 54% identical to QUEG_ROSLO: Epoxyqueuosine reductase (queG) from Roseobacter litoralis (strain ATCC 49566 / DSM 6996 / JCM 21268 / NBRC 15278 / OCh 149)

KEGG orthology group: None (inferred from 100% identity to mag:amb0780)

Predicted SEED Role

"Epoxyqueuosine (oQ) reductase QueG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W991 at UniProt or InterPro

Protein Sequence (360 amino acids)

>AMB_RS03995 tRNA epoxyqueuosine(34) reductase QueG (Magnetospirillum magneticum AMB-1)
MSGADAKSLIRDDDVKAAIRRRALDLGFSDVGFARAQGLPEWKADLDAYLADGRHGTMGW
MAETADRRADPQVLWPDAKSVIVLGTNYAPSGDPLKLTHLPERGNISVYARNRDYHDLLK
RRLKALGRWMAETWGGELKVFVDTAPVMEKPLAAQGGLGWRGRHTNIVSRRFGSWLFLAE
VFTTLEIEPDAPEADHCGSCRACVEACPTRALDGEGRIDPRRCISYLTIESKSPIPEDLR
PGLGNRLYGCDDCMAACPWNKFAPPTTEPDFLPRVELTAPRLADLVQLDEAGFREVFTAS
PVKRAGYERLMAGVLIAAANGGQTDLLAEAERRRDDPSPLIQDAARWAVSVLGGQGPGEL