Protein Info for AMB_RS03925 in Magnetospirillum magneticum AMB-1

Annotation: glycine cleavage system protein T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 TIGR00528: glycine cleavage system T protein" amino acids 11 to 365 (355 residues), 332 bits, see alignment E=2e-103 PF01571: GCV_T" amino acids 13 to 258 (246 residues), 288.2 bits, see alignment E=4.9e-90 PF08669: GCV_T_C" amino acids 286 to 364 (79 residues), 65.4 bits, see alignment E=3.5e-22

Best Hits

Swiss-Prot: 46% identical to GCST_MESCR: Aminomethyltransferase, mitochondrial (GDCST) from Mesembryanthemum crystallinum

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 100% identity to mag:amb0766)

MetaCyc: 49% identical to glycine cleavage system T protein (Chlamydomonas reinhardtii)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27 or 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9A5 at UniProt or InterPro

Protein Sequence (371 amino acids)

>AMB_RS03925 glycine cleavage system protein T (Magnetospirillum magneticum AMB-1)
MTQSETPMLTVPLDALHRELGAKMVPFAGYSMPVQYPAGVLAEHLHTRSGAALFDVSHMG
QASIRGAKAVELLETLVPGDIQALGLGKTRYSVFTNDQGGILDDLMISKLAEDHLFLVIN
AACKHADFAHLKAHLGDKVELSMIEDRSLLALQGPGAAAAMVTLCPEAGAMTFMTIAEIT
VAGIKCLATRSGYTGEDGWEISVANADVETLARAILAAPGVMPAGLGARDSLRLEAGLCL
YGSDIDTTTTPVEASIAWIMSKRRRAEGGFPGAAVIQKQLAEGAPRRRVGIQPDGKAPAR
AHTEITDEAGNRLGEICSGGFGPSAGGPVAMGYVPAAFAGVGTKLKLVVRGKAMDAHVCD
LPFVPHRYFKG