Protein Info for AMB_RS03925 in Magnetospirillum magneticum AMB-1

Annotation: glycine cleavage system protein T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00528: glycine cleavage system T protein
  • amino acids 11 to 365 (355 residues), 332 bits, E=2e-103
• PF01571: GCV_T
  • amino acids 13 to 258 (246 residues), 288.2 bits, E=4.9e-90
• PF08669: GCV_T_C
  • amino acids 286 to 364 (79 residues), 65.4 bits, E=3.5e-22

Best Hits

Swiss-Prot: 46% identical to GCST_MESCR: Aminomethyltransferase, mitochondrial (GDCST) from Mesembryanthemum crystallinum

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 100% identity to mag:amb0766)

MetaCyc: 49% identical to glycine cleavage system T protein (Chlamydomonas reinhardtii)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• photorespiration I (7/9 steps found)
• glycine degradation (2/3 steps found)
• folate transformations I (9/13 steps found)
• photorespiration III (6/9 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• photorespiration II (6/10 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Nitrogen metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27 or 2.1.2.10

Sequence Analysis Tools

See Q2W9A5 at UniProt or InterPro

Protein Sequence (371 amino acids)

>AMB_RS03925 glycine cleavage system protein T (Magnetospirillum magneticum AMB-1)
MTQSETPMLTVPLDALHRELGAKMVPFAGYSMPVQYPAGVLAEHLHTRSGAALFDVSHMG
QASIRGAKAVELLETLVPGDIQALGLGKTRYSVFTNDQGGILDDLMISKLAEDHLFLVIN
AACKHADFAHLKAHLGDKVELSMIEDRSLLALQGPGAAAAMVTLCPEAGAMTFMTIAEIT
VAGIKCLATRSGYTGEDGWEISVANADVETLARAILAAPGVMPAGLGARDSLRLEAGLCL
YGSDIDTTTTPVEASIAWIMSKRRRAEGGFPGAAVIQKQLAEGAPRRRVGIQPDGKAPAR
AHTEITDEAGNRLGEICSGGFGPSAGGPVAMGYVPAAFAGVGTKLKLVVRGKAMDAHVCD
LPFVPHRYFKG