Protein Info for AMB_RS03910 in Magnetospirillum magneticum AMB-1

Annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00938: homoserine kinase" amino acids 1 to 313 (313 residues), 411.8 bits, see alignment E=9.4e-128 PF01636: APH" amino acids 27 to 263 (237 residues), 161.8 bits, see alignment E=1.2e-51

Best Hits

Swiss-Prot: 100% identical to KHSE_MAGSA: Homoserine kinase (thrB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02204, homoserine kinase type II [EC: 2.7.1.39] (inferred from 100% identity to mag:amb0763)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9A8 at UniProt or InterPro

Protein Sequence (326 amino acids)

>AMB_RS03910 homoserine kinase (Magnetospirillum magneticum AMB-1)
MAVYTEVSDDELEDFAAEYDIGQVVSCKGIAEGVENTNYLLQTDQGNYILTLYEKRVNPE
ELPFFLGLMEHLAAHGLACPTPIHGRDGKALRTLCGRPAAIVSFLKGMWSRRITLGHCAE
LGPAMATMHLAGADFPLTRANNLSVAGWRPLFESIRPRAAEIKSDLAQSIEDELDYLEAH
WPRTLPVGLIHADLFPDNVFFLADKAAGVDRMSGFIDFYFACTDVLAYDIAICLNAWCFE
EDGAFNATKARLMLNGYRRVRPLSADELDALPLLARGAAMRFLLTRSYDWLHTPPGAMVK
RKDPMEYYRKLRFHQGVTGPGQYGIE