Protein Info for AMB_RS03890 in Magnetospirillum magneticum AMB-1

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 173 to 338 (166 residues), 168.1 bits, see alignment E=7e-54 PF00990: GGDEF" amino acids 177 to 336 (160 residues), 166.1 bits, see alignment E=3e-53

Best Hits

KEGG orthology group: K13590, diguanylate cyclase (inferred from 100% identity to mag:amb0759)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9B2 at UniProt or InterPro

Protein Sequence (352 amino acids)

>AMB_RS03890 GGDEF domain-containing protein (Magnetospirillum magneticum AMB-1)
MKSPDTLDVAAHCARAALAMMERHKVPPHPENYAIWYAYVAGRNPDLTAAIDAILQSGKK
FTAKVNDELYERFAVFPQDTAELREVGQRVEEAVGRVLEYLSNANQGTSNYGAALEDFSG
KLADGPSAAGLSELISGILAETKVMADLNRQLEQRLENSSNEVARLRNHLDDLKREASTD
ALTQLANRKLFDHSLNLAVLDARAADAPLSLLMIDIDHFKQFNDTYGHQLGDQVLKLVAR
SLSEVAQAKDTAARYGGEEFAVILPATPLEKSMEVAETIRNQVSTKRLTNRRTGQVLGQV
TLSIGAALLREAEAPDSLVHRADEAMYLAKRDGRNRVKSEIDLEKPTGEAAK