Protein Info for AMB_RS03850 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome b561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 178 (170 residues), 67.8 bits, see alignment E=5.4e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0750)

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9C1 at UniProt or InterPro

Protein Sequence (229 amino acids)

>AMB_RS03850 cytochrome b561 (Magnetospirillum magneticum AMB-1)
MSQQKFRLWDLPTRLFHWSLVLAVAAASVSGQLGGGLMAWHGRIGLTIIGLLVFRLAWGL
VGSTYARFAQFVPTPGAVRAYLRGEWHGEGHNPLGALAVFGLLGILSLQAATGLFANDDI
AFRGPLYDLAGKSLSNGLTAVHHLASKLIYLLVAVHVGAMVFYALVRKQNLIGPMLTGRK
DGPGRSASGGGVAALAVALVLAALAVFGAGGGWMPPPPPPPPAAATPDF