Protein Info for AMB_RS03845 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 44 to 64 (21 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 308 to 332 (25 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 359 (339 residues), 110.7 bits, see alignment E=3.9e-36 amino acids 272 to 394 (123 residues), 39.1 bits, see alignment E=2.3e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0749)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9C2 at UniProt or InterPro

Protein Sequence (404 amino acids)

>AMB_RS03845 MFS transporter (Magnetospirillum magneticum AMB-1)
MSRPAWLSPAIVLVFIGGAMMMSVSMGARQAQGLLIGPLSLERQWPLATFSLAVAIHNLM
WGFFQPFTGAAADRYGAAKVAAFGALTFGLGMMMVGAGGVALTTIGLGVVSGFGLAATSF
AVVLGPVGRAVSPEHRSSAMGMGSALGSLGMMAMIPLAQWLIGAFGPTQAVWILSAFSLA
SIPLALVLAKGEKASRPAASTLAHQSIGQALREAWGHPGYRLLAAGFFVCGFQVTFIGVH
LPGYLALCGMSKGAGATALLVIGGFNVIGTWLMGQLSQKYRPKYVLSAIYLGRAVVTFAF
VMGPKNEWTLLAFAASIGLLWLSTVPPTSTLIASVFGPRYLGMLFGLVFFTHQLGSFLGS
WLGGLIYDATLSYDVMWAGTAVLGLFAALVHLPIRDQTLARAAA