Protein Info for AMB_RS03825 in Magnetospirillum magneticum AMB-1

Annotation: DUF86 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF01934: HepT-like" amino acids 13 to 103 (91 residues), 107.9 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 39% identical to Y101_METAC: UPF0331 protein MA_0101 (MA_0101) from Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

KEGG orthology group: None (inferred from 100% identity to mag:amb0745)

Predicted SEED Role

"protein of unknown function DUF86"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9C6 at UniProt or InterPro

Protein Sequence (124 amino acids)

>AMB_RS03825 DUF86 domain-containing protein (Magnetospirillum magneticum AMB-1)
MTFKDWRVRIEDMIEAIERIRRYTEGMDDRRFVADDRTVDAVVRNLEIIGEAAKRVPFNV
LERHPDIPWSRMSEMRNILVHEYHSVDPSIIFDTARHDLPPLLGPLRALLNERNGNGNGN
GNGG