Protein Info for AMB_RS03820 in Magnetospirillum magneticum AMB-1
Annotation: KR domain-containing protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 41% identical to Y5909_MYXXD: Uncharacterized oxidoreductase MXAN_5909 (MXAN_5909) from Myxococcus xanthus (strain DK 1622)
KEGG orthology group: None (inferred from 100% identity to mag:amb0744)Predicted SEED Role
"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of type II polyketide products
- Biosynthesis of unsaturated fatty acids
- Bisphenol A degradation
- Butanoate metabolism
- C21-Steroid hormone metabolism
- Fructose and mannose metabolism
- Glycine, serine and threonine metabolism
- Insect hormone biosynthesis
- Linoleic acid metabolism
- Nucleotide sugars metabolism
- Polyketide sugar unit biosynthesis
- Retinol metabolism
- Tetrachloroethene degradation
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.-
Use Curated BLAST to search for 1.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W9C7 at UniProt or InterPro
Protein Sequence (253 amino acids)
>AMB_RS03820 KR domain-containing protein (Magnetospirillum magneticum AMB-1) MTKPFSSVLITGASSGLGAGLARICAAPGVTLHLSGRDRNRLDAAAKQCEALGAAVHATP LDVTDSAATARWVTDSDAIRPLDLVIANAGISAGTGGGGETEAQTRAIFAVNVNGVFNTV MPAIPLLRQRRRGQVGIMSSLAGFRGFAGAPAYCASKAAIRVWGESLRAELAPAGIGVSV ICPGFVETPMTAVNRFRMPFLMDVERASRIMVRGLARNRGRIAFPWPMHLMARLAGCLPS ALMDRIAAGLPRK