Protein Info for AMB_RS03805 in Magnetospirillum magneticum AMB-1

Annotation: DUF420 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details PF04238: DUF420" amino acids 7 to 135 (129 residues), 140 bits, see alignment E=2.7e-45

Best Hits

KEGG orthology group: K08976, putative membrane protein (inferred from 100% identity to mag:amb0741)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9D0 at UniProt or InterPro

Protein Sequence (140 amino acids)

>AMB_RS03805 DUF420 domain-containing protein (Magnetospirillum magneticum AMB-1)
MTAAGTLPHITAFLNAVSLAFLITGFVHIRAGRKDSHRKAMLGAVGASALFLAFYVVYHF
AAPIFVFRGTGVVRPIYYALLISHVLLAAVVAPMVALTLVRALKGQFDLHPKIARWTLPL
WLYVSITGIVVYLMLYHIYI