Protein Info for AMB_RS03760 in Magnetospirillum magneticum AMB-1

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 5 to 196 (192 residues), 238.9 bits, E=2.7e-75
• PF00117: GATase
  • amino acids 6 to 192 (187 residues), 157.3 bits, E=9.4e-50
• PF07722: Peptidase_C26
  • amino acids 73 to 175 (103 residues), 35.4 bits, E=2.5e-12
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 207 to 518 (312 residues), 471 bits, E=1.7e-145
• PF02540: NAD_synthase
  • amino acids 215 to 247 (33 residues), 26.3 bits, see alignment (E = 1e-09)
• PF03054: tRNA_Me_trans
  • amino acids 221 to 254 (34 residues), 24 bits, see alignment (E = 7.1e-09)
• PF00958: GMP_synt_C
  • amino acids 426 to 517 (92 residues), 147.4 bits, E=2.6e-47

Best Hits

Swiss-Prot: 80% identical to GUAA_RHORT: GMP synthase [glutamine-hydrolyzing] (guaA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to mag:amb0732)

MetaCyc: 57% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See Q2W9D9 at UniProt or InterPro

Protein Sequence (518 amino acids)

>AMB_RS03760 glutamine-hydrolyzing GMP synthase (Magnetospirillum magneticum AMB-1)
MSERILIVDFGSQVTQLIARRVREAGVYCEIHPFNRVSVDSIREFGPKGVILSGGPASVA
DFGSPRAPQGLFEMGLPILGICYGQQTMCEQLGGKVEPGDHREFGRAMLQVSGEPCALFD
GIAAKGDEVQVWMSHGDRVTAIPPGFKVVATSEGAPFAAIANADKRFYGVQFHPEVVHTP
IGKQLLSNFVHKIVGCAGDWTMKAFRAQEIAKVRAQVGSGRVICGLSGGVDSSVVAALLH
EAIGDQLTCVFVDTGFMRAGESEQVVSVFRDRFNIKLVHKDASGLFLDKLASLTDPEKKR
KIIGATFIDVFEEEAKAVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERM
NMKLVEPLRELFKDEVRALGRELGLPADMVGRHPFPGPGLAIRIPGQPLTRENLDILRKA
DSIYLDEIRKAGLYDEIWQAFAVLLPVRTVGVMGDSRSYDYACALRAVTSTDGMTADFYP
FDMAFIGRVANRIINEVKGINRVTYDITSKPPGTIEWE