Protein Info for AMB_RS03705 in Magnetospirillum magneticum AMB-1

Annotation: lipoate-protein ligase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00214: lipoyl(octanoyl) transferase
  • amino acids 38 to 209 (172 residues), 162.5 bits, E=4.3e-52

Best Hits

Swiss-Prot: 100% identical to LIPB_MAGSA: Octanoyltransferase (lipB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03801, lipoyl(octanoyl) transferase [EC: 2.3.1.181] (inferred from 100% identity to mag:amb0721)

Predicted SEED Role

"Octanoate-[acyl-carrier-protein]-protein-N-octanoyltransferase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.181

Sequence Analysis Tools

See Q2W9F0 at UniProt or InterPro

Protein Sequence (212 amino acids)

>AMB_RS03705 lipoate-protein ligase B (Magnetospirillum magneticum AMB-1)
MNYPVEWRISDSPVDYPQAIAAMEERVAAIRAGTAPELVWLLEHPPLYSAGTSADPRDLV
DPGRFPVYETGRGGQYTYHGPGQRVAYVLLDLKRRGADVRVYVCNLEEWLIRTLARFVVK
GERRTGRVGIWVDRGGGREDKIAAIGVRVRHWVTFHGIALNVDPDLSHFEGIVPCGIREH
GVTSLWDLGLTPTMDDVDCALMATFPEVFGAD