Protein Info for AMB_RS03680 in Magnetospirillum magneticum AMB-1

Annotation: UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR03588: UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase" amino acids 6 to 396 (391 residues), 524.3 bits, see alignment E=8.7e-162 PF01041: DegT_DnrJ_EryC1" amino acids 15 to 393 (379 residues), 354 bits, see alignment E=1.6e-109 PF01212: Beta_elim_lyase" amino acids 21 to 221 (201 residues), 38.1 bits, see alignment E=1.7e-13 PF00155: Aminotran_1_2" amino acids 33 to 166 (134 residues), 43.7 bits, see alignment E=3.2e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0717)

Predicted SEED Role

"Putative aminotransferase, DegT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9F4 at UniProt or InterPro

Protein Sequence (398 amino acids)

>AMB_RS03680 UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase (Magnetospirillum magneticum AMB-1)
MSGEAFLPYCRHVVDEDDIAAVAAVMRGDILTTGPAVAAFEDALAKVVGARHAVVCANGT
AALHLAVLALEIGPGDAVLVPAQTFAATGNCARYAGAEVVLTDVDPDSGLMRVGDLEAAM
AAHPGKRFKAVLPVHLNGQSADMPGLAAVARRHGLKIIEDCCHALGTVAADGTVIGDCRH
GEMNVFSFHPAKTIAMGEGGAITTNDEALATRLRLLRGHGITRDSAVFVDQEGGFDDSGA
PNPWYYEMQALGFNYRACDIQCALGTSQLAKLPRFAEARRRLVRHYRDRLAPLAPKVKPI
TLSGGEAVWHLSVALIDYQACGTTRAQVMNALRARGIGTQVNYIPMHKLPYYRGLLGDIS
LPGAEEYYRRCLSLPLSAAMTEADVDRVVETLREVLGL