Protein Info for AMB_RS03675 in Magnetospirillum magneticum AMB-1

Annotation: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03589: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
  • amino acids 31 to 353 (323 residues), 534.9 bits, E=3e-165
• PF00106: adh_short
  • amino acids 34 to 178 (145 residues), 29.5 bits, E=2.3e-10
• PF04321: RmlD_sub_bind
  • amino acids 35 to 206 (172 residues), 37.7 bits, E=5.7e-13
• PF01370: Epimerase
  • amino acids 36 to 255 (220 residues), 82.3 bits, E=1.7e-26
• PF02719: Polysacc_synt_2
  • amino acids 36 to 312 (277 residues), 342.5 bits, E=8.8e-106
• PF05368: NmrA
  • amino acids 36 to 153 (118 residues), 22.9 bits, E=2.3e-08
• PF16363: GDP_Man_Dehyd
  • amino acids 37 to 204 (168 residues), 47.7 bits, E=7.3e-16
• PF01073: 3Beta_HSD
  • amino acids 37 to 163 (127 residues), 50.4 bits, E=7.6e-17
• PF07993: NAD_binding_4
  • amino acids 38 to 161 (124 residues), 22.9 bits, E=1.9e-08
• PF13460: NAD_binding_10
  • amino acids 40 to 160 (121 residues), 35.8 bits, E=3.5e-12

Best Hits

Swiss-Prot: 59% identical to PSEB_HELPY: UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (pseB) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: None (inferred from 100% identity to mag:amb0716)

MetaCyc: 59% identical to UDP-N-acetylglucosamine 4,6-dehydratase subunit (Helicobacter pylori 26695)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

• CMP-pseudaminate biosynthesis (4/6 steps found)
• UDP-N-acetyl-β-L-fucosamine biosynthesis (1/4 steps found)
• UDP-N-acetyl-β-L-quinovosamine biosynthesis (1/4 steps found)
• CMP-diacetamido-8-epilegionaminic acid biosynthesis (2/7 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

See Q2W9F5 at UniProt or InterPro

Protein Sequence (360 amino acids)

>AMB_RS03675 UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (Magnetospirillum magneticum AMB-1)
MGACHDPPKRHSRRRSDALTASQYYDIDLDLEGKSILVTGGTGSFGKKFVKTVLERYNPH
RLIIFSRDELKQFEMAQTFDPAQHRCLRYFLGDVRDAERLRMAMREVDVVVHAAALKQVP
AAEYNPFEFVRTNILGAENVVQAALANKVGHVIALSTDKAMSPINLYGATKLASDKIFVA
ANNLSGSVGTKFAVVRYGNVVGSRGSVVPFFHKLIQSGAAELPITDARMTRFWITLEQGV
DFVLSCLDKMQGGETYIPKIPSMRMTDLAEAMAPGKPHKIIGIRPGEKIHEVMITEDYAR
NTVELPDRYIIQPVFAFWTTEHLIDAGAKVVPDDFRYGSDNNTDWMDGPRLHAMLSGLEL