Protein Info for AMB_RS03670 in Magnetospirillum magneticum AMB-1

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF13302: Acetyltransf_3" amino acids 3 to 132 (130 residues), 60.1 bits, see alignment E=7.8e-20 PF13673: Acetyltransf_10" amino acids 33 to 139 (107 residues), 24.7 bits, see alignment E=4e-09 PF00583: Acetyltransf_1" amino acids 35 to 132 (98 residues), 42.7 bits, see alignment E=1.3e-14 PF13508: Acetyltransf_7" amino acids 52 to 133 (82 residues), 27.7 bits, see alignment E=5.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0715)

Predicted SEED Role

"N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.7.7.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.43

Use Curated BLAST to search for 2.7.7.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9F6 at UniProt or InterPro

Protein Sequence (157 amino acids)

>AMB_RS03670 N-acetyltransferase (Magnetospirillum magneticum AMB-1)
MEFRRAVIQDASDLLVWRNDPDTIANSLTGKAVAEADHFAWIARVLASPDFILLMAEQAG
EKLGMVRFDREEDGEWEVSINLNPAARGRGLAADLLAGSIAAAFPAGARPPLVAWVKQSN
PASLRIFERCGFIHEGDEDGVETFRLAPSCGDGGRMP