Protein Info for AMB_RS03660 in Magnetospirillum magneticum AMB-1

Annotation: pseudaminic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR03586: pseudaminic acid synthase" amino acids 16 to 341 (326 residues), 510.5 bits, see alignment E=9.5e-158 PF03102: NeuB" amino acids 38 to 274 (237 residues), 286.1 bits, see alignment E=2.1e-89 PF08666: SAF" amino acids 290 to 348 (59 residues), 37.8 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: K01654, N-acetylneuraminate synthase [EC: 2.5.1.56] (inferred from 100% identity to mag:amb0713)

Predicted SEED Role

"N-acetylneuraminate synthase (EC 2.5.1.56)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.5.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.56

Use Curated BLAST to search for 2.5.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9F8 at UniProt or InterPro

Protein Sequence (348 amino acids)

>AMB_RS03660 pseudaminic acid synthase (Magnetospirillum magneticum AMB-1)
MTEISIAGRPIGPDHPPFIIAEMSANHNGDLGRALALLEAAAAAGADAVKLQTLKPDAIT
IDCDRPDFVIEGGPWGGRKLYDLYAEAQTPWDWHAKLFERGRELGLIVFSSPFDKAAVDF
LAGLDAPAFKIASFEMADPGLVAHAAAKGKPIIVSTGMAGLGDIAATVETVRRAGNDQLV
LLHCISSYPAPTEEANLATIPHMAQAFGVPVGLSDHTQGTAVAVTAVALGACVVEKHFTL
RRADGGLDSHFSLEPEELAQLVKDCRTAWVARGRISYALAECEQGSKAFRRSLYVVEDLH
PGEIITEDKVRSIRPGYGLEPKFLPEILGRKARKAVPRGTAFDWSMIE