Protein Info for AMB_RS03650 in Magnetospirillum magneticum AMB-1

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 675 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00009: GTP_EFTU" amino acids 10 to 273 (264 residues), 95.4 bits, see alignment E=6.8e-31 PF14492: EFG_III" amino acids 383 to 452 (70 residues), 56.6 bits, see alignment E=4.4e-19 PF03764: EFG_IV" amino acids 454 to 571 (118 residues), 141.5 bits, see alignment E=2.3e-45 PF00679: EFG_C" amino acids 574 to 663 (90 residues), 67.2 bits, see alignment E=2.2e-22

Best Hits

Swiss-Prot: 52% identical to EFGL_SYNY3: Elongation factor G-like protein (sll0830) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to mag:amb0711)

Predicted SEED Role

"Translation elongation factor G-related protein" in subsystem Translation elongation factor G family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9G0 at UniProt or InterPro

Protein Sequence (675 amino acids)

>AMB_RS03650 elongation factor G (Magnetospirillum magneticum AMB-1)
MTSKSPSLPRACALVGPFASGKTSLLEAMLLACGAIGRQGRIKDGTTTGDSSPEARARLM
SVEPNMASAEYLGEKWTFIDCPGSVEFQQDSYNALMAVDVAVVVCEPDPARAVMVAPVLK
FLDEHKVPHLLFVNKIDTAGTRLKETLEALQAVSDRPLIMREIPIREGDAVTGYIDLVSE
RAYKYRPGQTSAVIKIPEALKGEESAARQEMLEHLADFDDHLMEELLEDLQPPADEIYAD
LGKDLTGDLIVPVFFGSAENDGGIHRLLKALRHDAPGPAATAARLGIKAEGGPLATVFKT
VHAAHTGKLSFSRVWRGEFADNQSLEAGRIGGLYVMTGGTPTKVAKAGVGEVCAFGRLDS
VATGAVIGGAGEDMAAWPQPLAPLFAFALAAEKKGDDVKLTGAIAKLAEEDPSLSLDHGE
FGEQILRGQGEIHLQVAIDRLKSRFNMAVVTRKPTVPYKETIRKGTSVHGRHKKQSGGHG
QFGDIHIDIAPLPRGSGFHFVDKIVGGVVPRQYIPSVEEGVSEFLHQGPFGFPVVDLQVT
LTSGSYHAVDSSDMAFKTAARIAMSEGMPQCDPVLLEPILAVEISVPSDFTAKAQRIVSG
RRGQILGYDAKDGWQGWDNVSAYLPQAEMDDLIVELRSLTMGVGTFSWKFDHLQEITGRV
ADKVVEARKEALASA