Protein Info for AMB_RS03645 in Magnetospirillum magneticum AMB-1

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 108 to 123 (16 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details PF00378: ECH_1" amino acids 9 to 259 (251 residues), 162.7 bits, see alignment E=1e-51 PF16113: ECH_2" amino acids 14 to 202 (189 residues), 109.4 bits, see alignment E=2.8e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0710)

Predicted SEED Role

"Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" in subsystem Benzoate transport and degradation cluster or HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.2.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.18

Use Curated BLAST to search for 4.2.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9G1 at UniProt or InterPro

Protein Sequence (260 amino acids)

>AMB_RS03645 enoyl-CoA hydratase (Magnetospirillum magneticum AMB-1)
MTDHIHVKISGAVATVTLRRPELHNALDEQMVGNLAQTFQKLSVAEAVRVVVIEGQGPSF
CAGGDIGWTRAMLDQDAEEVSRSAMQMAVMLDAIDRCAKPVIARVQGAALGMGAGIVSVA
DMVVAADDSSFSLPEVRAGFPPTLIMPYLAAAMGTRAMRRYVLSGERFDAREALRLGLIH
AVVAGDKLDSARDLMVESCLKGAPKAQGAAKDMLRVVDDSPAGPDLMRYTVAQFVDARAG
AECREGVLALTEKRKPNWSV