Protein Info for AMB_RS03485 in Magnetospirillum magneticum AMB-1

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 127 to 152 (26 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 284 to 308 (25 residues), see Phobius details PF03547: Mem_trans" amino acids 168 to 306 (139 residues), 46 bits, see alignment E=1.5e-16

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to mag:amb0678)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9J3 at UniProt or InterPro

Protein Sequence (312 amino acids)

>AMB_RS03485 AEC family transporter (Magnetospirillum magneticum AMB-1)
MIQVLSALAPIIALIILGHQMRSRGWVDDAFWAPAEWATFHLFLPALLVASLARARLEGL
PVGTIFAVEAGLVVVMAATAGLAARRLEQPPWSLDGPAFTSLFQCVIRPNTYVALAVGAG
LWGSQGVALIAVCTAAVIPLVNLLSTLAMLHWARTDGRLGWREAVLPVITNPLILSCAVG
AAINLSGLRLPPVAASILDILGGASLPLALLAIGAGIRLESLRQPAPSVWLAIAAKMVVL
PLLAYGALKAAGLGGAILGACGIYAALPASPASYVTARRMGGDAALVATMLSAQTIAGAV
ILPLWLMVLGAG