Protein Info for AMB_RS03465 in Magnetospirillum magneticum AMB-1

Annotation: acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 transmembrane" amino acids 410 to 431 (22 residues), see Phobius details amino acids 452 to 470 (19 residues), see Phobius details PF00289: Biotin_carb_N" amino acids 1 to 109 (109 residues), 158.4 bits, see alignment E=3.8e-50 PF02786: CPSase_L_D2" amino acids 116 to 321 (206 residues), 253.1 bits, see alignment E=8.8e-79 PF02222: ATP-grasp" amino acids 139 to 291 (153 residues), 33.1 bits, see alignment E=2e-11 PF07478: Dala_Dala_lig_C" amino acids 142 to 290 (149 residues), 29.9 bits, see alignment E=1.7e-10 PF02785: Biotin_carb_C" amino acids 335 to 443 (109 residues), 133.4 bits, see alignment E=1.6e-42 PF13533: Biotin_lipoyl_2" amino acids 596 to 634 (39 residues), 24.6 bits, see alignment 8e-09 PF00364: Biotin_lipoyl" amino acids 596 to 659 (64 residues), 69.6 bits, see alignment E=7.4e-23

Best Hits

KEGG orthology group: K01968, 3-methylcrotonyl-CoA carboxylase alpha subunit [EC: 6.4.1.4] (inferred from 100% identity to mag:amb0674)

Predicted SEED Role

"Methylcrotonyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Serine-glyoxylate cycle (EC 6.4.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.4

Use Curated BLAST to search for 6.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9J7 at UniProt or InterPro

Protein Sequence (665 amino acids)

>AMB_RS03465 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha (Magnetospirillum magneticum AMB-1)
MFDKILIANRGEIACRVMRTAKRLGIRTVAVYSEADANAMHVAMADEAVLIGPAAAAESY
LKGDVILEAAKRTGAQAIHPGYGFLSENAGFAEACAKAGVVFIGPPVGAIHAMGSKAESK
RLMEAAGVPLVPGYHGKGQTLEELTREAAIIGYPVLVKASAGGGGKGMRVVSEASGLAEA
VASAKREAKAAFGDDSLLLETYLGRPRHVEIQVFCDTHGNGVYLFERDCSIQRRHQKVIE
EAPAPALADETRRAMGEAAVAAAQAVDYVGAGTVEFLYQDGRFFFIEMNTRLQVEHPVTE
MITGLDLVEWQLLVASGGKLPLAQEQLSRKGHAFEARLYAEDPSRDFLPAIGKLVHLAPP
SENRHVRVDTGVRQGDQVTPFYDPMIAKLIVWDEDRDSALRRLRRALADYQVAGVTTNVS
FLGAIAAHPAFAALEIDTGFIERYRADLQPPAAPVPAMGLAFASLALLLWREEDSARTAA
RSGDPHSPWHQTNGWRLNDDNHHDFRFMDGADERRVTVHFVADGWSLDLPDQTLSARRAT
LSGTTLSAEIGGERRTASVVRSGFDITVLHDGHAWKIKLDDPSATAAEREGGDGRLAAPM
PGTVVQVLVQPGDAVTAGQPLIVVEAMKMEHAIKAPAEGKVAAIHFKVGDTVAEGVELLA
FEVKE