Protein Info for AMB_RS03450 in Magnetospirillum magneticum AMB-1

Annotation: DUF4239 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details PF14023: DUF4239" amino acids 54 to 225 (172 residues), 28.9 bits, see alignment E=5.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0671)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9K0 at UniProt or InterPro

Protein Sequence (268 amino acids)

>AMB_RS03450 DUF4239 domain-containing protein (Magnetospirillum magneticum AMB-1)
MTTILGTYDHYGYAAIALLGTFVGAWFLLWVTLRSPWADELHTWRGVSPPFLGVVGVLFA
LTLAFLANDTWNAHDRALNAVYQEADGLRSIDALAEHLPAPIKARVVGAVRDYARITVTE
EWPLLARRQNSRAASDQLDRLLSLLAGPDVSAVAPTGVHGLMLSQAVQVRAARGLRIALS
QTHVNPLKWLGMAFLGFLTMISIAMVHVDQGRAEILAMVIFAAAAAPTAAIVLVQGNPFQ
QPTVVHAGPIAALAAEPGAQSSGAGGAR