Protein Info for AMB_RS03275 in Magnetospirillum magneticum AMB-1

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 PF11638: DnaA_N" amino acids 4 to 65 (62 residues), 79.6 bits, see alignment E=2.8e-26 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 464 (459 residues), 571.8 bits, see alignment E=5.7e-176 PF00308: Bac_DnaA" amino acids 131 to 347 (217 residues), 293.1 bits, see alignment E=3.9e-91 PF01695: IstB_IS21" amino acids 166 to 270 (105 residues), 27.2 bits, see alignment E=6.9e-10 PF00004: AAA" amino acids 168 to 274 (107 residues), 28.6 bits, see alignment E=4.3e-10 PF08299: Bac_DnaA_C" amino acids 375 to 443 (69 residues), 108.7 bits, see alignment E=2.9e-35

Best Hits

Swiss-Prot: 62% identical to DNAA_RHOS4: Chromosomal replication initiator protein DnaA (dnaA) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to mag:amb0636)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9N5 at UniProt or InterPro

Protein Sequence (466 amino acids)

>AMB_RS03275 chromosomal replication initiator protein DnaA (Magnetospirillum magneticum AMB-1)
MAKSEWDRVKVRLKDEVGDAAYRSWLRPITLHDMSEDAVKLALPTRFMRDWVNTHYAERI
RTLWGAENPAIRNVEIVVEAARAVSVAQNAAKASVAKVVPSPAAAPVRAAAAPCAPAAAP
NADNDELGAPLDNRFTFKNFVVGKPNEFAWAAARRVAEADQVSFNPLFLYGGVGLGKTHL
MHAIAHHIRERNPERSVLYLSAEKFMYRFIRALRGQDTMSFKEQFRSVDVLMIDDVQFIA
GKDATQEEFFHTFNALVDQGRQIVISADKSPSDLEGIEERLRSRMACGLVADIHATTYEL
RLGILHSKAEQMGVLVPQKVMEFLAHKIISNVRELEGALNRVVAHSQLVGRAITLETTQE
VLHDLLRASDRRITIEEIQKKVAEHFTIKLAEMSSARRSRQVARPRQIAMYLAKQLTSRS
LPEIGRKFGGRDHTTVMHAVKKVEELKECDQNFAEDVELLRRMLQG