Protein Info for AMB_RS03255 in Magnetospirillum magneticum AMB-1

Annotation: bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR00577: DNA-formamidopyrimidine glycosylase" amino acids 1 to 278 (278 residues), 266.3 bits, see alignment E=1.5e-83 PF01149: Fapy_DNA_glyco" amino acids 1 to 115 (115 residues), 120.2 bits, see alignment E=7.6e-39 PF06831: H2TH" amino acids 134 to 224 (91 residues), 94.6 bits, see alignment E=2.9e-31

Best Hits

Swiss-Prot: 59% identical to FPG_RHORT: Formamidopyrimidine-DNA glycosylase (mutM) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K10563, formamidopyrimidine-DNA glycosylase [EC: 3.2.2.23 4.2.99.18] (inferred from 100% identity to mag:amb0632)

Predicted SEED Role

"Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)" in subsystem DNA Repair Base Excision (EC 3.2.2.23)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 3.2.2.23 or 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9N9 at UniProt or InterPro

Protein Sequence (279 amino acids)

>AMB_RS03255 bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase (Magnetospirillum magneticum AMB-1)
MPELPEVETVARGLAQVWDGRRFVSVETRRAGLRVPFPKDFARRLTGRTVEAVGRRAKYL
VVRLDGGLVMLGHLGMSGRMTIGALRNEPPGPHDHVEWVTDQGISVTLTDPRRFGLFALC
EASDLGGHPLLAGIGPEPLDEAFDAGVLAKALAGKTGPIKTVLLDQKVVAGLGNIYVCES
LFRAEISPLRPAGSLSRAEVGRLVPLIKAVLSEAVAAGGSTLRDHARPDGELGYFQHSFQ
VYGREGETCPGCPGAPACGGILRMTQAGRSTFYCAKRQR