Protein Info for AMB_RS03250 in Magnetospirillum magneticum AMB-1

Annotation: bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF01209: Ubie_methyltran" amino acids 18 to 251 (234 residues), 265.9 bits, see alignment E=8.2e-83 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 28 to 250 (223 residues), 262 bits, see alignment E=1.8e-82 PF13489: Methyltransf_23" amino acids 51 to 235 (185 residues), 30.9 bits, see alignment E=6.4e-11 PF13847: Methyltransf_31" amino acids 67 to 173 (107 residues), 45.2 bits, see alignment E=2.5e-15 PF08242: Methyltransf_12" amino acids 71 to 167 (97 residues), 40.6 bits, see alignment E=1.1e-13 PF08241: Methyltransf_11" amino acids 71 to 169 (99 residues), 76.3 bits, see alignment E=7.1e-25 PF13649: Methyltransf_25" amino acids 71 to 165 (95 residues), 69.5 bits, see alignment E=9.9e-23

Best Hits

Swiss-Prot: 57% identical to UBIE_DINSH: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 100% identity to mag:amb0631)

MetaCyc: 57% identical to 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (Cereibacter sphaeroides)
RXN-9235 [EC: 2.1.1.201]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)" in subsystem Menaquinone Biosynthesis via Futalosine or Menaquinone and Phylloquinone Biosynthesis or Ubiquinone Biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.163

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9P0 at UniProt or InterPro

Protein Sequence (252 amino acids)

>AMB_RS03250 bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE (Magnetospirillum magneticum AMB-1)
MTDSHSHNDGTTHFGFKTVAEDEKVSLVRGVFDSVASKYDLMNDLMSAGVHRLWKSAFLD
MLRPRPDQTLLDVGGGTGDIAFGWRKRGGGPVTVCDINREMLSVGRDRAVDRNLVGGLTW
VCGNAEDLPIPDRSVDRYTIAFCLRNVTHWDKAIAEAYRVLRPGGRFMCLEFSRVIVPGL
REAYDAYSFNVLPKVGGMVTGNAEAYQYLVESIRKFPPQEEMAAMVEAAGFSRVEVRNLS
AGIAAIHSGWRI