Protein Info for AMB_RS03240 in Magnetospirillum magneticum AMB-1

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00072: Response_reg" amino acids 3 to 113 (111 residues), 103.6 bits, see alignment E=7.2e-34 PF00486: Trans_reg_C" amino acids 145 to 221 (77 residues), 74.5 bits, see alignment E=5.8e-25

Best Hits

Swiss-Prot: 72% identical to CTRA_OCHA4: Cell cycle response regulator CtrA (ctrA) from Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

KEGG orthology group: K13584, two-component system, cell cycle response regulator CtrA (inferred from 100% identity to mag:amb0629)

Predicted SEED Role

"Two-component cell cycle transcriptional regulator ctrA, winged helix family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9P2 at UniProt or InterPro

Protein Sequence (238 amino acids)

>AMB_RS03240 DNA-binding response regulator (Magnetospirillum magneticum AMB-1)
MRVLVVEDDQLMSRAIESMLKAEGMVVDTTALGEDGLEIGKLYDYDIILLDLMLPDMDGY
EVLRRLRSARIDTPVLILSGLSEPDKKIKGLGSGADDYLTKPFDKGELVARIQAIVRRSK
GHAQSVIDTGKLSVNLDARTVAVTGDPLHLTAKEYGILELLSLRKGQTLTKEQFLNHLYG
GIDEPELKIIDVFICKLRKKLATATGGESYIETVWGRGYVLRDPDMPAVNSNKAGAAE