Protein Info for AMB_RS03225 in Magnetospirillum magneticum AMB-1

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 18 to 46 (29 residues), see Phobius details amino acids 52 to 89 (38 residues), see Phobius details amino acids 107 to 115 (9 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details PF09335: VTT_dom" amino acids 35 to 154 (120 residues), 33.9 bits, see alignment E=2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0626)

Predicted SEED Role

"FIG139438: lipoprotein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9P5 at UniProt or InterPro

Protein Sequence (192 amino acids)

>AMB_RS03225 DedA family protein (Magnetospirillum magneticum AMB-1)
MLKGLYDWMMAKAAHRHAIWWLAAISFIESSFFPIPPDVMLIPMVIAAPTRWLRIAMVCT
ASSVAGGYLGYAIGHFAMDSIGMAILGAFHLQEKFLALKPIIDEWGVWFIIVKGATPIPY
KLVTITAGAFDFDLMKFTFASVVARGMRFVLVAALLWKFGPPVREFVERRLKLVTTVFVI
VLVGGFFMVKLL