Protein Info for AMB_RS03210 in Magnetospirillum magneticum AMB-1

Annotation: DNA polymerase IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF00817: IMS" amino acids 48 to 195 (148 residues), 159.7 bits, see alignment E=5e-51 PF11799: IMS_C" amino acids 282 to 385 (104 residues), 96.3 bits, see alignment E=1.5e-31

Best Hits

Swiss-Prot: 57% identical to DPO41_RHILO: DNA polymerase IV 1 (dinB1) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 100% identity to mag:amb0623)

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9P8 at UniProt or InterPro

Protein Sequence (393 amino acids)

>AMB_RS03210 DNA polymerase IV (Magnetospirillum magneticum AMB-1)
MGTYGDHMAAVCRDCGALGVGEAPLCPACGSSRRVRHPELADLTIAHIDCDAFYASVEKR
DNPALADKPVIVGHPGGRGVVTTACYVARKFGPRSAMPMFKALELCPHAVVIPPNIAKYK
QVSAQIRALFEKATPLVEPLSLDEAYLDLSPGVRLVDRPAAVLLARLARAIRLQVGITVS
VGLSYNKFLAKMASDLNKPEGFSVIGREEAEAFLAPRPVTALFGIGAATAARMADQGITT
IAQLQALPETEFVARWGKFGRRLAGMVHGIDHRPVNPDRPAKSVSTETTFARDIRDAKAL
TEALPPLAEGVARRLERVNLAGRTVVLKLKTADFKVITRHLRLPDPTGRAETIVRAGLAL
LERQMDGRAFRLLGIGVTDLCPAEEADPPDLFG