Protein Info for AMB_RS03205 in Magnetospirillum magneticum AMB-1

Annotation: DNA recombination/repair protein RecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR02012: protein RecA" amino acids 15 to 336 (322 residues), 576.1 bits, see alignment E=1.1e-177 PF00154: RecA_N" amino acids 18 to 280 (263 residues), 481.9 bits, see alignment E=1.3e-148 PF08423: Rad51" amino acids 50 to 238 (189 residues), 33.9 bits, see alignment E=5.1e-12 PF06745: ATPase" amino acids 51 to 125 (75 residues), 30.7 bits, see alignment E=5.3e-11 PF27531: MT3502_N" amino acids 65 to 163 (99 residues), 32.2 bits, see alignment E=2.8e-11 PF21096: RecA_C" amino acids 283 to 338 (56 residues), 90.9 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 100% identical to RECA_MAGSA: Protein RecA (recA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to mag:amb0622)

MetaCyc: 68% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9P9 at UniProt or InterPro

Protein Sequence (359 amino acids)

>AMB_RS03205 DNA recombination/repair protein RecA (Magnetospirillum magneticum AMB-1)
MSQAALRLVDKDTMDRQKALEAAVSQIERAFGKGSIMKLGGKDQVVETEVVSTGSLGLDV
ALGIGGVPRGRIIEVYGPESSGKTTLALHIIAEAQKKGGTCAFVDAEHALDPSYARKLGV
NLDELLISQPDAGEQALEIADTLVRSGAVDVLVVDSVAALVPRAELEGEMGDNHMGLHAR
LMSQALRKLTGSVSKSKTIVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRMEIRRVG
AIKDRDEVVGNQTRVKVVKNKLAPPFKVVDFDIMYGEGISKMGELIDLGVKANVVEKSGA
WFSYNSTRIGQGRENAKTFLRENPAMAAEIEGAIRQNAGLISEALAGGPGDLDGTPVEE