Protein Info for AMB_RS03195 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 796 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details amino acids 34 to 40 (7 residues), see Phobius details PF08448: PAS_4" amino acids 70 to 173 (104 residues), 25.5 bits, see alignment E=5.1e-09 amino acids 190 to 234 (45 residues), 30.5 bits, see alignment 1.4e-10 amino acids 301 to 408 (108 residues), 55.3 bits, see alignment E=2.9e-18 TIGR00229: PAS domain S-box protein" amino acids 180 to 277 (98 residues), 25.6 bits, see alignment E=5.4e-10 amino acids 292 to 411 (120 residues), 54.7 bits, see alignment E=5.7e-19 PF13188: PAS_8" amino acids 184 to 240 (57 residues), 18.6 bits, see alignment 5.7e-07 amino acids 295 to 346 (52 residues), 28.6 bits, see alignment 4e-10 PF00989: PAS" amino acids 185 to 232 (48 residues), 25.4 bits, see alignment 4.9e-09 amino acids 296 to 399 (104 residues), 39 bits, see alignment E=2.9e-13 PF13426: PAS_9" amino acids 195 to 279 (85 residues), 22.2 bits, see alignment E=5.7e-08 amino acids 305 to 406 (102 residues), 27.1 bits, see alignment E=1.7e-09 PF00512: HisKA" amino acids 423 to 487 (65 residues), 35.5 bits, see alignment E=3.3e-12 PF02518: HATPase_c" amino acids 530 to 650 (121 residues), 76 bits, see alignment E=1.3e-24 PF00072: Response_reg" amino acids 679 to 789 (111 residues), 64.3 bits, see alignment E=4.5e-21

Best Hits

KEGG orthology group: K13587, two-component system, cell cycle sensor histidine kinase and response regulator CckA [EC: 2.7.13.3] (inferred from 100% identity to mag:amb0620)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9Q1 at UniProt or InterPro

Protein Sequence (796 amino acids)

>AMB_RS03195 PAS domain-containing sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MNLRIKSLPDPLSLCLAASVAGTAMLGVAEAGWPAISAAALVAAVAGSMLWQRSRRPAGI
APILAGALESESRAVLVVASDGAELYRNQAARRLLGGAADPLAPLKALAAADDRALAEME
RLDAAAAVGAPRRTEVTLVSAGGGREWLTLEVRPAGSPQAVAWIAEDVSARRAIDETLRR
ENELLSDFVDLLPVGCYSADADGTVRYVNQRLAEWLGKAGDEILGRNLAEVFGIVPNPEE
ERAELRLRGRSGEVFQALVAHSVFDEGGEMFTRSVVVRDLVPEQQWEKALRAAERRFRWL
FDDAPVGIALVDLDGAVGACNLALQAMLGIDRDDMIGRPVIDVVAEENRPAASEQLGKVI
AGSTPGTHLEVRLKGRRNLIAQLFVSPSHEDGDISGLVIHFIDATEQRNLEMQFAQSQKM
QAMGQLAGGVAHDFNNLLTAMIGFCDLLLQRHGAGDPSFADIMQVKQNANRAASLVRQLL
AFSRRQALQPRLLNVTDALAELSNLLRRLLGETIELRMIHGRALGLVRVDPGQFDQVIIN
LAVNARDAMPGGGALTIRTNAVHVDQPIQRGPELMPAGDYVQIEVADTGTGIGKENLARI
FEPFFSTKEVGAGTGLGLSTVYGIVRQTDGFIFVESEPGQGATFSIYLPRIDADPAAETK
RAPLPSEAAGADLTGSGTILLVEDEDAVRLFGARALRNKGYTVIEARSGEQAMEVLNGGE
PIQVLISDVVMPGMDGVTLARFVRMERPAIKVILISGYSEDVARDGIDPDAGIHFLPKPF
SLRQLAGAVKQVMDEG