Protein Info for AMB_RS03185 in Magnetospirillum magneticum AMB-1

Annotation: flagellar type III secretion system protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 217 to 242 (26 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 11 to 245 (235 residues), 185 bits, see alignment E=9.1e-59 PF01311: Bac_export_1" amino acids 11 to 244 (234 residues), 192.9 bits, see alignment E=3.2e-61

Best Hits

Swiss-Prot: 37% identical to FLIR_CAUVC: Flagellar biosynthetic protein FliR (fliR) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to mag:amb0618)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9Q3 at UniProt or InterPro

Protein Sequence (254 amino acids)

>AMB_RS03185 flagellar type III secretion system protein FliR (Magnetospirillum magneticum AMB-1)
MLTDLLQLDIFRFFLVFTRIGAALMLFPGLGGSLVSTRIRLLLALSVAFVMLPVVGASFP
AVPRSVGGMLLAVFGEAVVGVYLGTVIMFIMSTLNMAGSMIGYQTGLTNAFSFDPIAQQQ
SQLLTGFLANIGLVAVFATDMHHLMFQAVFESYYLFPPGQPLQFGDYAETLGHLATDTFK
VGTQFAAPLVVFGLVFYTGLGLLSRLVPQLQVFFVGMPVQVMVGMWLFMVTMPLVISLFL
RFFESGLMPYVQPR