Protein Info for AMB_RS03180 in Magnetospirillum magneticum AMB-1

Annotation: flagellar biosynthetic protein FliQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details TIGR01402: flagellar biosynthetic protein FliQ" amino acids 1 to 84 (84 residues), 96.2 bits, see alignment E=4.7e-32 PF01313: Bac_export_3" amino acids 6 to 77 (72 residues), 100.8 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 44% identical to FLIQ_CAUVC: Flagellar biosynthetic protein FliQ (fliQ) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02420, flagellar biosynthetic protein FliQ (inferred from 100% identity to mag:amb0617)

Predicted SEED Role

"Flagellar biosynthesis protein FliQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9Q4 at UniProt or InterPro

Protein Sequence (89 amino acids)

>AMB_RS03180 flagellar biosynthetic protein FliQ (Magnetospirillum magneticum AMB-1)
MTEPELIDIARETIMVMLKVAAPTLLTGLVVGLVISIFQTLTQIQEQTLTFVPKMLLVFA
SMILFLPFMLHSLTEFWRLVMDRVVAGGG