Protein Info for AMB_RS03145 in Magnetospirillum magneticum AMB-1

Annotation: flagellar biosynthetic protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 48 to 80 (33 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 53 to 249 (197 residues), 296.4 bits, see alignment E=4.8e-93 PF00813: FliP" amino acids 54 to 245 (192 residues), 272.2 bits, see alignment E=1.4e-85

Best Hits

Swiss-Prot: 58% identical to FLIP_CAUVC: Flagellar biosynthetic protein FliP (fliP) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 100% identity to mag:amb0610)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9R1 at UniProt or InterPro

Protein Sequence (250 amino acids)

>AMB_RS03145 flagellar biosynthetic protein FliP (Magnetospirillum magneticum AMB-1)
MTRLASRRRMILAAAVGILTALAAGPVLAQSLNIDLGGPQASATSRIIQLIALTTVLSVA
PSILVMVTSFTRFVVVLGFLRQALGTQQSPPNTVMVSLAMFLTAFVMAPTFEKAWTDGIA
PVMDGHLDEIEGFERAVKPFHAFMSKHVRGQDLKLFMDLSRAKEVEKAEDAPLRALIPAF
MISELRRAFEIGFLIFLPFLIIDMVIASVLMSMGMMMIPPAMISLPFKLIFFVMVDGWYL
VVGSLVQSYG