Protein Info for AMB_RS03120 in Magnetospirillum magneticum AMB-1

Annotation: phosphatidylserine decarboxylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00164: phosphatidylserine decarboxylase homolog
  • amino acids 21 to 230 (210 residues), 176.2 bits, E=2.7e-56
• PF02666: PS_Dcarbxylase
  • amino acids 56 to 225 (170 residues), 154 bits, E=2.2e-49

Best Hits

Swiss-Prot: 100% identical to PSD_MAGSA: Phosphatidylserine decarboxylase proenzyme (psd) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to mag:amb0604)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (9/12 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (2/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (7/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (9/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

See Q2W9R7 at UniProt or InterPro

Protein Sequence (240 amino acids)

>AMB_RS03120 phosphatidylserine decarboxylase family protein (Magnetospirillum magneticum AMB-1)
MRGEAVQAQQISLTKYLWFPINREGWPFVGLFALGALLLGQIWGPLGWAGALLTCWCAWF
FRDPDRVTPTRDGLVISPADGVVQMVGMVAPPPELDMGDAPRMRISVFMSVFSVHINRCP
VDGTIVKCSYRPGKFLDASLDKASADNERMSVRMSRADGREIAFVQIAGLVARRIKCDLK
DGQQVRAGQRFGLIRFGSRVDVYLPDGVAPLVSLGQSIIAGETVLADLDSTEGARQGEIR