Protein Info for AMB_RS03080 in Magnetospirillum magneticum AMB-1

Annotation: prolyl aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR01249: prolyl aminopeptidase" amino acids 8 to 307 (300 residues), 365.7 bits, see alignment E=9.3e-114 PF00561: Abhydrolase_1" amino acids 34 to 293 (260 residues), 92.1 bits, see alignment E=4.8e-30 PF12146: Hydrolase_4" amino acids 35 to 162 (128 residues), 37.7 bits, see alignment E=1.4e-13

Best Hits

Swiss-Prot: 54% identical to PIP_ARATH: Proline iminopeptidase (PIP) from Arabidopsis thaliana

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 100% identity to mag:amb0597)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9S4 at UniProt or InterPro

Protein Sequence (313 amino acids)

>AMB_RS03080 prolyl aminopeptidase (Magnetospirillum magneticum AMB-1)
MELFPPFEPHATGALPVGDGHELYWEVSGNPDGPVVVFIHGGPGASTAPTYRRFFDPSFW
RIALFDQRGCGRSRPHASVEANTTAHLVADLEVLRHHLGVERWLLFGGSWGSTLALAYGQ
AHPGRCTGFVMRGIFLFRPDEVEWFMSGMGRFFPEAHRRFMAHLPEAERVRPLAAYLERL
THPDTHVHMPAARVWCGYEEACARLLPRDEGGDPDGPSTLALARIEAHYMAHQGFMRPNQ
LLDEMDRIRHLPAIIVQGRYDLVCPPQSAADLARAWPGCELRMVPDAGHSAMEPGIRAGL
VDAVERMKMRIRR