Protein Info for AMB_RS02835 in Magnetospirillum magneticum AMB-1

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details PF00672: HAMP" amino acids 182 to 233 (52 residues), 34.8 bits, see alignment 2.6e-12 PF00512: HisKA" amino acids 238 to 294 (57 residues), 33.4 bits, see alignment 5.9e-12 PF02518: HATPase_c" amino acids 336 to 441 (106 residues), 83.1 bits, see alignment E=3e-27

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 100% identity to mag:amb0548)

Predicted SEED Role

"Osmolarity sensor protein EnvZ (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9X3 at UniProt or InterPro

Protein Sequence (441 amino acids)

>AMB_RS02835 two-component sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MSHLGRWLKRLAPQGLLGRSLLIIIMPLVLLQLVSAYVFYGSHWESVAKRLAKGLAGDIG
TIIESLRAFPGEQERSLILSIAANKMELDTRFLPGAILPNQPRGAPSGLLERALTEALDE
RVQRPYRIDAESLEREVVIRVQLSDGMLEVFAPKKRLFSSTTYVFILWMLGTAMLLFGIA
TLFMRNQVRSVRKLAVAADRFGKGQDVADFKPEGAQEVRQAAQAFNLMRHRVQRQMQQRT
EMLAGVSHDLRTPLTRMKLQLAIMGDMDGRAELDEDVAEMERMVEGYLAFARGEGSEQPE
QVDLPALVDEVVTRFRRQGMVIDLHHEGEIVMPLRPDSLARALGNLIGNASRYGGHVWVR
VGRRGEAAEVLIDDDGPGIPPDQREEVFKPFTRLETSRNLATGGVGLGLTIARDIVRTHG
GDLLLEDSPLGGLRARVRLPL