Protein Info for AMB_RS02820 in Magnetospirillum magneticum AMB-1

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF03807: F420_oxidored" amino acids 3 to 91 (89 residues), 33.1 bits, see alignment E=7e-12 TIGR00112: pyrroline-5-carboxylate reductase" amino acids 4 to 261 (258 residues), 239.5 bits, see alignment E=2.4e-75 PF14748: P5CR_dimer" amino acids 155 to 261 (107 residues), 113.3 bits, see alignment E=6.5e-37

Best Hits

Swiss-Prot: 43% identical to P5CR_PSEAE: Pyrroline-5-carboxylate reductase (proC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 100% identity to mag:amb0545)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9X6 at UniProt or InterPro

Protein Sequence (263 amino acids)

>AMB_RS02820 pyrroline-5-carboxylate reductase (Magnetospirillum magneticum AMB-1)
MTKILLVGCGKMGSAMLAGWLERGVAPGDVVVVDPSSPDLGAVGVVTSDAAIPSAFVPDV
VIFAVKPQVMAEVVPPYARFDRSVFLSIAAGKTIAFFRNHLGAKAVIVRAMPNTPAAVRR
GITVCCAGEAVPAVARELCQSLLEAVGEVGWVDDEGLMDVVTAVSGSGPAYIFLLAEAME
AAGLAQGLPPALAERLARATVAGAGELLRLSAESAEQLRKNVTSPGGTTAAALSVLMAES
HGIPSLMTEAVAAATRRGRELAG