Protein Info for AMB_RS02805 in Magnetospirillum magneticum AMB-1
Annotation: nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to COBT_RUEPO: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (cobT) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
KEGG orthology group: K00768, nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC: 2.4.2.21] (inferred from 61% identity to rru:Rru_A0667)MetaCyc: 56% identical to nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase subunit (Pseudomonas denitrificans (nom. rej.))
Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase. [EC: 2.4.2.21]
Predicted SEED Role
"Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.4.2.21)
MetaCyc Pathways
- adenosylcobalamin biosynthesis II (aerobic) (28/33 steps found)
- adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
- superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
- superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
- 2-methyladeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- 5-hydroxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- 5-methoxy-6-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- 5-methoxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- 5-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- adeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- adenosylcobalamin biosynthesis from adenosylcobinamide-GDP I (3/3 steps found)
- benzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.4.2.21
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (339 amino acids)
>AMB_RS02805 nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (Magnetospirillum magneticum AMB-1) MNSSISSVAQIRSLLAALPGPDAAASAAWAAREPQLTKPAGSLGRLEEVSAWLSAWQGRH PPAMENPVARVYAGNHGVAALGVSAFPAEVTVQMVANFRRGGAAINQLCKTFGIGLDILA LDLDRPTADFTRGPAMDEAEFAAAFQAGMDSVPDGADVLVIGEMGIGNTTPAAAVSAALF GGEAADWTGRGTGVEGGALARKIEVVGQGVALHRGLAPLDILRCLGGRELAAMAGAVLAA RLGRVPVLLDGYVTTAAVAALELECKGALDHCLVGHVSVEPGHRRLLAALGKDALFDLGM RLGEGSGAALAVGVLKAAAACHAGMHTFAQAGVSDKDGA