Protein Info for AMB_RS02790 in Magnetospirillum magneticum AMB-1

Annotation: outer membrane receptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF07715: Plug" amino acids 60 to 147 (88 residues), 50.9 bits, see alignment E=2.1e-17 PF00593: TonB_dep_Rec_b-barrel" amino acids 226 to 664 (439 residues), 64.2 bits, see alignment E=2.3e-21

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to mag:amb0540)

Predicted SEED Role

"TonB dependent receptor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9Y1 at UniProt or InterPro

Protein Sequence (708 amino acids)

>AMB_RS02790 outer membrane receptor protein (Magnetospirillum magneticum AMB-1)
MTCHAIHRGGRRHGRVRLFATTFLTSVLASGVAPVLAEDIPEVVITAPRLSIPADARLDA
AGDTAKLLSRTPGLNLISNGGVSSLPDIHGLGDDRLKILVDGMETTSACSNHMNPPLSYI
DSSRVEKVEVWSGITPVSAGGDNIGGVISVKSAPPVFAGPGEGYAVGGRLSAFYKSVNDG
VGASVALHGANGTFSLGYDGSWAMGRDYYAGGDHRAVLSTLYEARNHALTFGARHEGHLL
VLEAGQHDIPYQGFSNQRMDMTGNRGVHGNGRYEGEFAWGKLEARGYWQQVKHAMDQIGG
EKNGKMPMRTDAIDLGYAVKGDIRVSDGKTIRVGQELHRFLLDDWWPPVAGSMSMAPNTF
KSINGGSRDVISAFAEWEEKWAPQWTTLLGVRSDTVLMDTGNVAGYVTTGTEAANAAAFN
AKNHAKTDFNFDLTALVRFEPNAISTNEFGYARKSRSPNLYERYSWSTTSMDSSMINWFG
DANGYVGDPGLRPEVAHTVSTSFALHDSGRKEWAAKVTPYFTYIADYIGVDWVSNSTTRS
SVFPLLKFANHDAMMSGVDVSGSTFLARETGYGDFKVSGMIGWLHGEMVNTGKAMYHVMP
INGKAALEHGWGGWTNAVEAQLVGTKAGVDPLRREPKTPGYALLNLRSGYEWENFLLNLG
IDNVFDKRYYHPLGGVDYSEWRRHSLTGQVGALPAPGRSFNAGVTVKF