Protein Info for AMB_RS02740 in Magnetospirillum magneticum AMB-1

Annotation: nitrite reductase (NAD(P)H) small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13806: Rieske_2
  • amino acids 3 to 100 (98 residues), 52.3 bits, E=5e-18
• PF00355: Rieske
  • amino acids 3 to 80 (78 residues), 66.8 bits, E=1.3e-22
• TIGR02378: nitrite reductase [NAD(P)H], small subunit
  • amino acids 4 to 102 (99 residues), 90.3 bits, E=4.1e-30

Best Hits

Swiss-Prot: 44% identical to NASE_BACSU: Assimilatory nitrite reductase [NAD(P)H] small subunit (nasE) from Bacillus subtilis (strain 168)

KEGG orthology group: K00363, nitrite reductase (NAD(P)H) small subunit [EC: 1.7.1.4] (inferred from 100% identity to mag:amb0532)

Predicted SEED Role

"Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

• alkylnitronates degradation (1/2 steps found)
• nitrate reduction V (assimilatory) (1/2 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.4

Sequence Analysis Tools

See Q2W9Y9 at UniProt or InterPro

Protein Sequence (111 amino acids)

>AMB_RS02740 nitrite reductase (NAD(P)H) small subunit (Magnetospirillum magneticum AMB-1)
MQDWIKIGRVEDIPRLGARTVQTDKGDIAVFRTRDDEIFALFNRCPHKGGPLSEGIVTGK
VVVCPLHSWTIDLETGEATAPDEGCTRPVDSKVVDGLVWLKLESAKKVAHG