Protein Info for AMB_RS02665 in Magnetospirillum magneticum AMB-1

Annotation: cobyrinate a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01656: CbiA
  • amino acids 19 to 208 (190 residues), 62.4 bits, E=6.3e-21
• TIGR00379: cobyrinic acid a,c-diamide synthase
  • amino acids 19 to 449 (431 residues), 331.3 bits, E=5.1e-103
• PF13500: AAA_26
  • amino acids 95 to 204 (110 residues), 28.4 bits, E=2.1e-10
• PF07685: GATase_3
  • amino acids 263 to 450 (188 residues), 112.3 bits, E=3.4e-36

Best Hits

Swiss-Prot: 55% identical to COBB_RHOCB: Hydrogenobyrinate a,c-diamide synthase (cobB) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 59% identity to rru:Rru_A3359)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (28/33 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (11/13 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.-, 6.3.5.9

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Protein Sequence (456 amino acids)

>AMB_RS02665 cobyrinate a,c-diamide synthase (Magnetospirillum magneticum AMB-1)
MAEGKAGAENRGGAGSKGLIIAAPSSGSGKTTLTLGLLRLLARKGLAVGSVKVGPDYIDP
AFHAAASGRPCYNLDSWAMRPESLGALAARAASGAELLVCEGVMGLFDGAFVPAGQPDGS
TADLAAATGWPVVLVIDGRGMTGSAAAVLAGFAHLRPEVRIGGVIFNRVVGDKHKAAIAA
ACARACPGISLLGFLPPSSGLETPSRHLGLVQAAERADLQTFLDGAAALVAEHVDVDGLA
ALAQPSRLAGGSLGAMIPPLGARIAVARDTAFAFAYPALLEGWRQAGAELSFFSPLADQG
PDEAADAVYLPGGYPELHAGRLAGNAGFLNGLRRAAAAGAVLYGECGGYMVLGRGMEDAQ
GVRHAMAGLLGLETSFARRRLHLGYRRAALYAAGPLGEAGQGYRGHEFHYASVLAEQGAP
LFSVADAPGADLGHAGLVEGRVTGSFVHLIDRFAGS