Protein Info for AMB_RS02230 in Magnetospirillum magneticum AMB-1

Annotation: methylenetetrahydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02219: MTHFR
  • amino acids 16 to 290 (275 residues), 320 bits, E=7.4e-100
• TIGR00676: methylenetetrahydrofolate reductase [NAD(P)H]
  • amino acids 20 to 290 (271 residues), 337.8 bits, E=2.3e-105

Best Hits

Swiss-Prot: 58% identical to METF_SHIFL: 5,10-methylenetetrahydrofolate reductase (metF) from Shigella flexneri

KEGG orthology group: K00297, methylenetetrahydrofolate reductase (NADPH) [EC: 1.5.1.20] (inferred from 65% identity to amv:ACMV_02440)

MetaCyc: 58% identical to 5,10-methylenetetrahydrofolate reductase (Escherichia coli K-12 substr. MG1655)
RXN-22438 [EC: 1.5.1.54]

Predicted SEED Role

"5,10-methylenetetrahydrofolate reductase (EC 1.5.1.20)" in subsystem Methionine Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 1.5.1.20)

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• folate transformations I (9/13 steps found)
• reductive acetyl coenzyme A pathway I (homoacetogenic bacteria) (3/10 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Methane metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.20 or 1.5.1.54

Protein Sequence (298 amino acids)

>AMB_RS02230 methylenetetrahydrofolate reductase (Magnetospirillum magneticum AMB-1)
MSLPRPELPIATACRKPVSVSFEFFPPKTEKMQVSLWECIQRLAPLAPQFVSVTYGAGGT
TRERTHETVVRIARETALKPAAHLTCVGHAKGEVDDIARRYWDEGIRHIVALRGDMPDGQ
PYVAHPQGYAYAADLVTGLKRIADFEISVAAYPEKHPDAPSAEFDLDNLKRKIDAGANRA
ISQYFFDPAVFLAFRERAAQAGITVPILPGILPVTNFAQVQKFSAACGASIPGWMADLFE
GLDDDPETRRLVAATMAAEQCRILAAEGVEQFHFYTLNRADLAYAISHILGVRPKAAG