Protein Info for AMB_RS02200 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 61 to 90 (30 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 167 to 169 (3 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 234 to 266 (33 residues), see Phobius details PF19656: DUF6159" amino acids 65 to 273 (209 residues), 76.9 bits, see alignment E=1e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0425)

Predicted SEED Role

"Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WA96 at UniProt or InterPro

Protein Sequence (291 amino acids)

>AMB_RS02200 hypothetical protein (Magnetospirillum magneticum AMB-1)
MNSFFRGWHIAKASLGVLRAQPKLMILPICSAAAMLGIIALTLPLLAVFSAGNADENTTD
ILVLVTAFGGYIACYFAMLFFNAALIFCSIRYFETGSTTIGEGLAAAGRRALPIFLWALI
AGTIGLILRIIGETLTRLARKEFGAIVAFVVKLLTAGLYGLWLAASYFALPVLVVEGVGP
IDAVRRSTHLIKTHWGDVLGGQSMLGLLTLLAILIPGALVGGLVYLAQDAAQAYLGILVG
IGAVYLGLVMLVSSVLGIIFLAGVYMFTATGKAPDIFGEDLVGSALKTKAA