Protein Info for AMB_RS02185 in Magnetospirillum magneticum AMB-1

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF03480: DctP" amino acids 56 to 319 (264 residues), 150.8 bits, see alignment E=2.6e-48

Best Hits

Swiss-Prot: 59% identical to DCTP_RHOFT: Solute-binding protein Rfer_1840 (Rfer_1840) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: None (inferred from 100% identity to mag:amb0422)

Predicted SEED Role

"TRAP transporter solute receptor, unknown substrate 4"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WA99 at UniProt or InterPro

Protein Sequence (342 amino acids)

>AMB_RS02185 C4-dicarboxylate ABC transporter (Magnetospirillum magneticum AMB-1)
MKISRRQALAGLAGAPALLSFGRTGFAQPAATTLKISHQFPGGTIEQGDFRDRLCRLFAR
EVEKRTNGALKFEIYANSSLMKTNAQFSAMRKGALDMSLYPLPYAGGELHACNLGLMPCL
VTSYEQGARWKGAPIGKALSKILEDKGIKFIAWVWQAGGIASRRNPVLGPADVKGLTIRG
GSRETDMMFAAAGARVSTMPSNEIYIGMQTSALDAAVTSSTSLISFRLEELAKSLTAARK
GSFWFMLEPLLMSKAVFDSLPAAQQQVLLEVGAEMEAWGTAEAHRDDDQVAAVYGAKGCQ
VTDFSADHLAQWRKIAEESAWADYAAKSAEAAELLKLARDVS