Protein Info for AMB_RS02150 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 265 to 311 (47 residues), see Phobius details amino acids 318 to 331 (14 residues), see Phobius details TIGR03476: putative membrane protein" amino acids 18 to 332 (315 residues), 253.7 bits, see alignment E=1.3e-79 PF03706: LPG_synthase_TM" amino acids 24 to 316 (293 residues), 99.3 bits, see alignment E=1.6e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0416)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAA5 at UniProt or InterPro

Protein Sequence (346 amino acids)

>AMB_RS02150 hypothetical protein (Magnetospirillum magneticum AMB-1)
MAGDQPAQTGFGSAPVTMRAQLFIAAILGVGGLVTLTLAQDAGRLGDAFSSLGPAIVAIC
AYRALPIAAHTLGWRAVVPAADRPGFGAMLVMRWIGESINTLLPVGQVGGDVARARLMTS
GGVRTEAAGAQVAVDFLLGMASQAAFALMGVAALLLSAPGIAASLQVLAGTAILILLAGL
LAGLQRKGFFTGLSGVVKRLMGEETASRLARGAADLDREVALLLGQRPRMLAGFGWRLAG
WLAHVAESWILLAALGLPATLETALALESLAWAVRSIAFLIPGAIGAQEGGIVAVGLLLG
LPAESALALALAKRTREIVVCAPGLLVWLFIERRGIRSLLATERPH