Protein Info for AMB_RS02135 in Magnetospirillum magneticum AMB-1

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 48 (17 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 4 to 343 (340 residues), 71.2 bits, see alignment E=4.2e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0414)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAA7 at UniProt or InterPro

Protein Sequence (364 amino acids)

>AMB_RS02135 acyltransferase (Magnetospirillum magneticum AMB-1)
MGMIRLLLAICVVAGHSRGFFGAPLMGGGTAVQIFYVISGFYITLVLNEKYRERVRLFYS
NRLLRLVPSYMIVLLLAVIALAVFGRSTHASVDEWRAMFGQADLFATLYYIWVNIGMLGS
DQALFTYLTPDGSLGWTADFRPHALASYRFLLVPQSWSIGVELLFYAVAPFVVTRSPRLI
IGLMVVSYAARWSAYANGFAFDPWTYRFFPFELGTFFAGALAARFRQGLERNGGWLLLAV
WVATIGTYAATATVTMVGPVMDIVIRETALTWGMAFSLPAIYALSKSNGVDRFAGALSYP
LYICHHFVILAVAATSGADGLGGVKSMTVLAIALAVSVVLAVFVEIPVDRWRQNRALGNP
EMKA