Protein Info for AMB_RS01725 in Magnetospirillum magneticum AMB-1

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00168: translation initiation factor IF-3
  • amino acids 12 to 172 (161 residues), 223.1 bits, E=8.2e-71
• PF05198: IF3_N
  • amino acids 12 to 80 (69 residues), 105.4 bits, E=1.4e-34
• PF00707: IF3_C
  • amino acids 88 to 173 (86 residues), 133.7 bits, E=1.8e-43

Best Hits

Swiss-Prot: 68% identical to IF3_RUEPO: Translation initiation factor IF-3 (infC) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 100% identity to mag:amb0341)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

See Q2WAI0 at UniProt or InterPro

Protein Sequence (173 amino acids)

>AMB_RS01725 translation initiation factor IF-3 (Magnetospirillum magneticum AMB-1)
MQTPPKNDGPRVNREIDVRSIRLVGADGEMIGVVTLREGLVMAEEAGLDLVEVSPNADPP
VCKILDFGKFKYEDQKKKNAARKKQKVIEVKEVKLRPNIDDHDYDVKMRSMRKFLEEGDK
VKVTLRFRGRELAHQDLGMKVLERVRDDLEDLGKVEQIPKMEGRQMVMVISAK