Protein Info for AMB_RS01680 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 146 to 172 (27 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details PF02405: MlaE" amino acids 58 to 266 (209 residues), 225.8 bits, see alignment E=2.4e-71

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to mag:amb0332)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAI9 at UniProt or InterPro

Protein Sequence (271 amino acids)

>AMB_RS01680 ABC transporter permease (Magnetospirillum magneticum AMB-1)
MTSEAEPRGFIGFLDRLGRRAVAGIVEFGFGASLLGESLYWLGMGGKRRQPVRLAPVVAQ
AMEIGIGALPIVTVLSATIGIMLAIQGIYTLRLFGAESRVSLGVAMSVVREFGPLITGIL
VAGRSGSALAARLGTMRINQEIDALTVMGVSPVRFLVVPPLLAMMAMLPALTLWSDLVGL
FAAGLYIAPQLGSSMGAYVDEMTDLVRLNDIWHGLGKSAIFSVLITVVGVVNGASVTGGA
EGVGRMTTRSVVHAISAIVITDMIFVFMVTR