Protein Info for AMB_RS01580 in Magnetospirillum magneticum AMB-1

Annotation: small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 76 to 93 (18 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details PF21088: MS_channel_1st" amino acids 221 to 256 (36 residues), 32.9 bits, see alignment 7.6e-12 PF00924: MS_channel_2nd" amino acids 258 to 322 (65 residues), 59.3 bits, see alignment E=5e-20 PF21082: MS_channel_3rd" amino acids 329 to 415 (87 residues), 33.2 bits, see alignment E=8.5e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0311)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAL0 at UniProt or InterPro

Protein Sequence (426 amino acids)

>AMB_RS01580 small-conductance mechanosensitive channel (Magnetospirillum magneticum AMB-1)
MSAVAHNGVLRRLFATVLLLVSLGGGALAQTAAPPAPPPALPAAVPELPGQINAIGDKAA
DVMVQKMVDHSGRDQWGHTAVIVVLTLAVAFGADRLSRGAWHRFAGRRLSDEQRLRIRQR
LGWLRRILLGGLGTAVGLMVVQSLGVYNVLAVVGSEWGRRILSGLINIVLVLALAVVFWE
VLRAAIERYLSATDSDGNQLQRSGRVRTLLPLVRNAAFIMLVISVGLIVLSEIGVNIAPL
LAGAGVLGIAIGFGSQKLVQDIITGAFVLFEDTMAVGDAVKVGEHVGTVEAISIRAIKIR
DGNGALHTVPFGAVSTVVNSSRGFNYAAMDIPVAYEVETDKAAAVITDLGAEMRAEAGWG
AMMIDPVEVQGVERFDAASVVLRVRIKTTPGDRVTLIREFNRRLKQRFDAAGIAMSSPQA
QKVVSH